PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G196400.2
Common NameB456_011G196400, LOC105776456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 680aa    MW: 74533.7 Da    PI: 6.4674
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G196400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.87.8e-26213265155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G++ ++Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Gorai.011G196400.2 213 KPRVVWSVELHQQFVAAVNQL-GID-TVPKKILELMNVPGLTRENVASHLQKYRL 265
                         79*******************.888.8***************************8 PP

2Response_reg75.22.4e-25351431109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+p+ +++l+++l+   y +v+ +  +e al +l+e++  +D++l D+ mp+mdG++ll++i  e  +lp+i+++a + ++ + + 
  Gorai.011G196400.2  35 VLVVDDDPTCLMILEKMLTACLY-KVTKCNRAETALSKLRENKngYDIVLSDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKQVVMKG 123
                         89*****************9999.***************999999**********************6654.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +e+l +
  Gorai.011G196400.2 124 VTHGACDYLIKPVRIEALKN 143
                         ****************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363927.9E-1739671IPR017053Response regulator B-type, plant
SuperFamilySSF521725.98E-3532157IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.8E-4232173No hitNo description
SMARTSM004484.7E-3033145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.49634149IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2235143IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.03E-2736148No hitNo description
PROSITE profilePS5129410.283210268IPR017930Myb domain
SuperFamilySSF466896.09E-18210269IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27212270IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-22213265IPR006447Myb domain, plants
PfamPF002497.5E-8215264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    Send to blast
MNVSSVKGSM SISSSTSTWK AGDTISDQFP AGLRVLVVDD DPTCLMILEK MLTACLYKVT  60
KCNRAETALS KLRENKNGYD IVLSDVHMPD MDGFKLLEHI GLEMDLPVIM MSADDGKQVV  120
MKGVTHGACD YLIKPVRIEA LKNIWQHVVR KRKNEWKEFE QSGSVEEGDR QPKQSDDADY  180
SSSANEGNWK GSKRRKDEEE ETDERDDTST LKKPRVVWSV ELHQQFVAAV NQLGIDTVPK  240
KILELMNVPG LTRENVASHL QKYRLYLRRL SGVSQHQSNL STIISAQDPT FGSLSSLSGL  300
DLQTLAATGQ LPAQSLARLQ AAGLGRATAK SGIPITLVDQ RNIFSFENPK LRFGEGQQQH  360
MTNKQQVNLL HGIPTTMEAK QLVSLRHAAQ SVGNMNMQVP PPGPQSSQNN PLLMQMGQQQ  420
QQQQSRGQIL VDSTINHAPR LSSMGQPILS NGMATNVSSR NGIPENIRAP GYSQTPSMLN  480
FPMNHASELP GNCFPLGSTP GVSNLTSKGA FQEDVNSEIK GSGGFMPSYD VFNDLNQHKP  540
QSWELQNVGI AFDSSQHSNS LQGNLDLTQS ALGQQGFSSG QMNGHNRSAA VASKAVFSTG  600
DVKELRSAQN VNQHLNNLLV DNTIRVKSER VCDTSPANIF PDHFGQDDLM SALLKQQESV  660
ASSENEFDFD GYSMNNIPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-19212271464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3934651e-84GQ393465.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS0430 SSR marker CGR5416 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454565.10.0PREDICTED: two-component response regulator ARR2-like isoform X2
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A0D2TAL10.0A0A0D2TAL1_G
STRINGGLYMA07G37220.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.21e-180response regulator 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]